PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_901181FDD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 863aa    MW: 94353.5 Da    PI: 4.8441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_901181FDD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.52.4e-112331648
                           HHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           vk++G++ W+tIa+ ++ gR +kqc++rw+++l
  Traes_3DS_901181FDD.1  2 VKKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 33
                           9****************.*************97 PP

2Myb_DNA-binding49.31.2e-153981145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                           +++WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  Traes_3DS_901181FDD.1 39 KDAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 81
                           679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001672.47E-9133No hitNo description
PROSITE profilePS5129424.383137IPR017930Myb domain
SMARTSM007170.036135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-19140IPR009057Homeodomain-like
PfamPF002492.9E-9233IPR001005SANT/Myb domain
SuperFamilySSF466898.79E-281389IPR009057Homeodomain-like
SMARTSM007171.9E-143886IPR001005SANT/Myb domain
PROSITE profilePS5129419.9343888IPR017930Myb domain
PfamPF002494.7E-143982IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-214188IPR009057Homeodomain-like
CDDcd001673.42E-114181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MVKKYGPKKW STIAQALPGR IGKQCRERWH NHLNPGINKD AWTQEEEITL IHAHRMYGNK  60
WAELTKFLPG RTDNSIKNHW NSSVKKKIDS YMSSGLLAQV SRLPLIEHHA HFNSSPAITQ  120
QNSEDSDSNA AREVEDSSGC SQSSLAMVSC SQVQDTNLAL SCDLHVNADT SKTEARDSQS  180
SMCQEDYTST EGVASALSEV HCHASSSRFG PDKLLQQDIS QRMNLQMDID ETPGNSMFEN  240
NQTICSTSNN ERPMLQYEIA PDMPISVLTN VSGAEQKLHF MSEADFSSPN CLKSELWQEI  300
SFQSLLSGPD IVDADSLSRL NHHSDTHSSE ADTNFLAAPN PSHTSNPSSM MVAAYGQDPS  360
LSVPQSLISN GLSDAADEKS GEMQVSGSEM ITCMHDSFGD SEQFATPGST DGRHGASAII  420
ERIPEYGDKQ LTDAEEPAAS MAKEPPLAQG EAASDEKQDK GALFYEPPRF PSMDVPFVSC  480
DLVTSGDLQE YSPLGIRQLM RSTMSVTTPL RLWGSPTHDE SPDVVLKSAA KSFISTPSIL  540
KKRQRDLSSP TPEKRMERKS RTEQDSGVLG TSSVSAQTSC MHAIKDKAIV TESVFCTNRS  600
SSFKPLEKKL EFCDENKENL GESEQAKDGR NAQNNHTVDE HARGEQCSTA NMVNTNDEPL  660
ATVLVEHKGN DISDHGANAM YQKMNTNLEA LSACKEAFAK SKSGELIAEK SSPCIQMDYE  720
YVNILADTPG VKRGLESPSA WKSPWFIDMQ YKGSYFISPA DTTYDALGLM KRINVQSASA  780
LADAREVLAS GSQCGNKNFD EENKENIDAE NETGTGKPQN KIMAEARVLD FNECATPVRT  840
ADNSVGGSLT KSVSSPIPSS HLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-3918818105C-Myb DNA-Binding Domain
1msf_C2e-3918818105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE9968270.0HE996827.1 Triticum aestivum cv. Arina SNP, chromosome 3B, clone Taes_arina_ctg_69800.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLW5DIK30.0W5DIK3_WHEAT; Uncharacterized protein
STRINGMLOC_10556.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.12e-57Homeodomain-like protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]